PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17203A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 277aa    MW: 30049.6 Da    PI: 5.8432
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17203AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14e-181461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT  Ede+l+ +vk +G g+W+ ++++ g++R++k+c++rw++yl
  Oropetium_20150105_17203A 14 RGAWTSKEDEILAAYVKAHGEGRWREVPQRAGLRRCGKSCRLRWLNYL 61
                               89********************************************97 PP

2Myb_DNA-binding42.81.2e-1367126147
                                TSSS-HHHHHHHHHHHHHTTTT..............-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............tWktIartmgkgRtlkqcksrwqky 47 
                                rg+ + +E++l+++++k+lG++               W++Ia +++ gRt++++k++w++ 
  Oropetium_20150105_17203A  67 RGNISDDEEDLIIRLHKLLGNRsvllascccgggarMWSLIAGRLP-GRTDNEIKNYWNST 126
                                78999*****************************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-24664IPR009057Homeodomain-like
PROSITE profilePS5129424.948965IPR017930Myb domain
SuperFamilySSF466893.05E-2411123IPR009057Homeodomain-like
SMARTSM007178.8E-141363IPR001005SANT/Myb domain
PfamPF002493.5E-161461IPR001005SANT/Myb domain
CDDcd001671.50E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2065130IPR009057Homeodomain-like
SMARTSM007179.4E-1066129IPR001005SANT/Myb domain
PROSITE profilePS5129411.83266131IPR017930Myb domain
PfamPF002492.5E-1167126IPR001005SANT/Myb domain
CDDcd001671.35E-871127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRRACCAKE GVKRGAWTSK EDEILAAYVK AHGEGRWREV PQRAGLRRCG KSCRLRWLNY  60
LRPNIKRGNI SDDEEDLIIR LHKLLGNRSV LLASCCCGGG ARMWSLIAGR LPGRTDNEIK  120
NYWNSTLGRR VGAGGSAVST PDAGYHPTTP APGPSCDTDE ASASAPRGGP DNGTASEAVW  180
APKPVRCTED RLFFLRDATP PLEAETRTST RGEGSSDDCT SSSAASTFGG SGVDEVPCFS  240
DAGDWWMDDV RALESFLESD EEWVNRLQMT TDMMLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-22141317108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1350184e-79AY135018.1 Zea mays PL transcription factor (pl) mRNA, pl-bol3 allele, complete cds.
GenBankAY1350194e-79AY135019.1 Zea mays PL transcription factor (pl) mRNA, pl-W22 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659144.13e-96PREDICTED: anthocyanin regulatory C1 protein-like
SwissprotP102907e-89MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLQ8W0U39e-99Q8W0U3_SORBI; Putative anthocyanin regulatory C1
STRINGGRMZM2G005066_P011e-95(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-54myb domain protein 5